Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative transport permease ycf38 (ycf38)

This Recombinant Putative transport permease ycf38 (ycf38) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Putative transport permease ycf38

UniProt

P48278

Expression Region

1-290

Origin

Cyanophora paradoxa

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNFKLKNLRLSRLNQEKSSSVTSFFFIQELFVLVKRLFIQLKRRPITLISGILQPLLWLI LFGALFQKAPFRISNLENNYLQFFYPGILVFTAFAGSLNSSLPLIFDREFGFLNRLLVAP LNSRFSILFSSAFFISVLSFIQVFFIMLFGVFLGIQLPPFKSLIVSFFFLFLLIIGITTF SILLALLLPTHIELIAVIFVLNLPLLFSSTALAPLDFMPSWLQIISCLNPLTYTIEPIRF LYSHSSWLFSSSLFELSFFSINIGQSLIILIIFDLVGFLLFKKILKSIFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK Antibody
E10-30232 100 µg -100 µL

BLNK Antibody

Sign In for Pricing
View Details
CHSS2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-13928R-BF488 100 µL

CHSS2 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
KRT18P25 CRISPR Knock Out 293T Cell Line (Human)
25963141 1x 10^6 Cells / 1.0 mL

KRT18P25 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
AFP Antibody
orb1261129 100 µL

AFP Antibody

Sign In for Pricing
View Details
BDNF Antibody (HRP)
orb377479 100 µg

BDNF Antibody (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal PSP94/MSMB Antibody (OTI3D5) [Alexa Fluor 532]
NBP2-73625AF532 0.1 mL

Mouse Monoclonal PSP94/MSMB Antibody (OTI3D5) [Alexa Fluor 532]

Sign In for Pricing
View Details