Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P57970

Expression Region

1-290

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPISKQKWIAYAQLMRFDKPIGTLLLLWPTLWALFLSVKGMPDLSILSIFVLGVIFMRAA GCVINDYADRHIDGAVKRTSKRPLATGAATPEEAKWLFVLLVFCSFILVLFLNTYAIVLS FIAVFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEALPLECWLLFFANLAWTVA YDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIISLLQIVTLFFLGLIGYLSQLHTSYFVV LFLATLLFVYQCKLIKDRERESCFKAFLNNNYFGAMVFVAFLFGIFFDKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD73 (Immuno-Oncology Target) (NT5E/2646), CF488A conjugate, 0.1mg/mL
BNC882646-500 1x 500 µL

CD73 (Immuno-Oncology Target) (NT5E/2646), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF740 conjugate, 0.1mg/mL
BNC742883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (Extracell. non Ligand binding Site) Mouse Monoclonal Antibody [Clone ID: EGF-R2]
AM20237PU-S 10 µg

EGFR (Extracell. non Ligand binding Site) Mouse Monoclonal Antibody [Clone ID: EGF-R2]

Sign In for Pricing
View Details
NAP1L1 Human Gene Knockout Kit (CRISPR)
KN401851 1 Kit

NAP1L1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DCPS Human Gene Knockout Kit (CRISPR)
KN403052 1 Kit

DCPS Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sodium DL-Lactate (60% w/w in H2O)
TRC-S644003-1G 1 g

Sodium DL-Lactate (60% w/w in H2O)

Sign In for Pricing
View Details