Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Pasteurella multocida 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P57970

Expression Region

1-290

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPISKQKWIAYAQLMRFDKPIGTLLLLWPTLWALFLSVKGMPDLSILSIFVLGVIFMRAA GCVINDYADRHIDGAVKRTSKRPLATGAATPEEAKWLFVLLVFCSFILVLFLNTYAIVLS FIAVFLAFIYPFMKRYTHLPQLFLGMAFGWSIPMAYGASIEALPLECWLLFFANLAWTVA YDTQYAMVDRDDDLRIGVKSTAILFAQYDNKIISLLQIVTLFFLGLIGYLSQLHTSYFVV LFLATLLFVYQCKLIKDRERESCFKAFLNNNYFGAMVFVAFLFGIFFDKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF640R conjugate, 0.1mg/mL
BNC403075-100 1x 100 µL

CD44v4/5 (Marker of Tumor Metastasis) (3D2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CRELD2 Antibody
KC-8423-01 50 μL

CRELD2 Antibody

Sign In for Pricing
View Details
CRELD2 Antibody
KC-8423-02 100 µL

CRELD2 Antibody

Sign In for Pricing
View Details
CRELD2 Antibody
KC-8423-03 1 mL

CRELD2 Antibody

Sign In for Pricing
View Details
Fmoc-Asp (t-Bu) Wang Resin
H0370751305.1G 1 g

Fmoc-Asp (t-Bu) Wang Resin

Sign In for Pricing
View Details
Rhodium (5% on Alumina)
TRC-R318635-2.5G 2.5 g

Rhodium (5% on Alumina)

Sign In for Pricing
View Details