Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P0AGK3

Expression Region

1-290

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), 1mg/mL
BNUM2046-50 1x 50 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2046), 1mg/mL

Sign In for Pricing
View Details
Fenbuconazole-lactone A R-9129
TRC-T767725-5MG 5 mg

Fenbuconazole-lactone A R-9129

Sign In for Pricing
View Details
Syndecan 1 (SDC1) Human Gene Knockout Kit (CRISPR)
KN400419 1 Kit

Syndecan 1 (SDC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant MOG Antibody
RC-4855-01 50 μL

Recombinant MOG Antibody

Sign In for Pricing
View Details
Recombinant MOG Antibody
RC-4855-02 100 µL

Recombinant MOG Antibody

Sign In for Pricing
View Details
Recombinant MOG Antibody
RC-4855-03 1 mL

Recombinant MOG Antibody

Sign In for Pricing
View Details