Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P0AGK3

Expression Region

1-290

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MMP24 Human Gene Knockout Kit (CRISPR)
KN422100 1 Kit

MMP24 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44 / HCAM Std. (BU75), Biotin conjugate, 0.1mg/mL
BNCB1616-100 1x 100 µL

CD44 / HCAM Std. (BU75), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF640R conjugate, 0.1mg/mL
BNC400175-500 1x 500 µL

CD46 (122.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human LOC101928841 activation kit by CRISPRa
GA119496 1 Kit

Human LOC101928841 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS702840 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
Protein G Colloidal Gold, 1mL 15nm
GP-02-15 1 mL

Protein G Colloidal Gold, 1mL 15nm

Sign In for Pricing
View Details