Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P0AGK3

Expression Region

1-290

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Zfp219 (ZNF219) activation kit by CRISPRa
GA109656 1 Kit

Human Zfp219 (ZNF219) activation kit by CRISPRa

Sign In for Pricing
View Details
Napsin-A (NAPSA/1238), CF647 conjugate, 0.1mg/mL
BNC471238-100 1x 100 µL

Napsin-A (NAPSA/1238), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Nitroso Guvacoline-d4 (major)
TRC-N527627-1MG 1 mg

N-Nitroso Guvacoline-d4 (major)

Sign In for Pricing
View Details
T Cell Receptor (TCR) V beta-2 Mouse Monoclonal Antibody [Clone ID: TCR3]
AM08119FC-N 500 µg

T Cell Receptor (TCR) V beta-2 Mouse Monoclonal Antibody [Clone ID: TCR3]

Sign In for Pricing
View Details
TBCA (N-term) Rabbit Polyclonal Antibody
AP54174PU-N 400 µL

TBCA (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant PML Antibody
RC-15575-01 50 μL

Recombinant PML Antibody

Sign In for Pricing
View Details