Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Enterobacter sp. Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A4WE04

Expression Region

1-290

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSGYLHFPEFDPVIFSIGPVALHWYGLMYLVGFIFAMWLAGRRAGRPGSGWTKNEVENL LYAGFLGVFLGGRIGYVLFYNFPTFLSDPLYLFRVWDGGMSFHGGLIGVILVMVIFAKRT KRNFFQVADFMAPLIPFGLGAGRLGNFINGELWGRVDPSVPYTMLFPASRAEDIALLPSH PEWQSIFDTYGVLPRHMSQLYELALEGVVLFIILNLFIRKPRPMGSVSGLFLIGYGAFRI IVEFFRQPDAQFTGEWVQYISMGQILSIPMIVAGIIMMIWAYRRPQQQLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF740 conjugate, 0.1mg/mL
BNC740871-100 1x 100 µL

CD71 (66IG10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL
BNC040965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL
BNC471388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL
BNC471884-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details