Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant Salmonella enteritidis PT4 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

B5QZ59

Expression Region

1-290

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQSKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGMPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTVNRPLPSGAVTEKEARNLFVVLVLLAFLLVLTLNAMTIL LSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESLPLSCWLMFLANILWA VAYDTQYAMVDRDDDIKIGIKSTAILFGRYDTLIIGILQLGVMALMALIGWLNGLGWGYY WAVLVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF555 conjugate, 0.1mg/mL
BNC550322-100 1x 100 µL

CD3e (RIV9), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL
BNC472853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL
BNC681284-500 1x 500 µL

CD11c (Dendritic Cell Marker) (ITGAX/1284), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details