Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas stutzeri ATP synthase subunit a (atpB)

This Recombinant Pseudomonas stutzeri ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A4VS68

Expression Region

1-290

Origin

Pseudomonas stutzeri (strain A1501)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASTPAEYIQHHLQNLTYGKLPAGYERADGSILDQATWTIAQTGAEARDMGFMAVHLDTL GWSLLMGAIFILLFRSAAKAATAGVPGKLQNLVEMCVEFVEGVVKDTFHGRNPLIAPLAL TIFVWVFLMNSLKWIPVDYIPGIAHLLGLPAFKIVPTADPNGTFGLSLGVFILILFYSFK VKGFGGFTKELAFTPFNHWSLVPFNLFLEILGLLTKPLSLALRLFGNMYAGEVVFILIAL LPFYVQWTLNVPWAIFHILVIPLQAFIFMVLTVVYLSSAHEDHGHAELTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Shigella Flexneri hokE Protein (aa 1-50)
VAng-Lsx07849-500gEcoli 500 µg (E. coli)

Recombinant Shigella Flexneri hokE Protein (aa 1-50)

Sign In for Pricing
View Details
Fam45a sgRNA CRISPR Lentivector set (Rat)
K6043101 3x 1.0 µg

Fam45a sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
TM9SF4 Rabbit Polyclonal Antibody (Biotin)
orb2116150 100 µL

TM9SF4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit anti-human DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 polyclonal Antibody
MBS716851-01 0.1 mL

Rabbit anti-human DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 polyclonal Antibody
MBS716851-02 5x 0.1 mL

Rabbit anti-human DEAD (Asp-Glu-Ala-Asp) box polypeptide 28 polyclonal Antibody

Sign In for Pricing
View Details
AGTPBP1 Protein Vector (Human) (pPB-C-His)
PV001041 500 ng

AGTPBP1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details