Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmF (msmF)

This Recombinant Multiple sugar-binding transport system permease protein msmF (msmF) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmF

UniProt

Q00750

Expression Region

1-290

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIRKVLNKYWGWTFLIVPLILQVVFFYFPMFQGAFYSFTNWTGLTYNFDFVGINNYKIL MTDGKFMKAIGFTLVLTLALIVGEIVLGIIIARALNAKIKGKTFFRAWFFFPAVLSGLTV SLIFKQVFNYGLPAVGSALGIKFLETSMLGTANGAVIASIFVLLWQGVAMPIILFLSGLQ SIPSEIVEAAAIDGADSKQTFWSVELPYLLPSISMVFIMALKAGLTAFDQIFALTGGGPN NSTTSLGLLVYNYAFKSNQYGYANAIALILFIIIGIVSVLQIKLSKKFEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethyl-4-hydrazinylpiperidine dihydrochloride
ZDA66999-01 50 mg

1-Ethyl-4-hydrazinylpiperidine dihydrochloride

Sign In for Pricing
View Details
1-Ethyl-4-hydrazinylpiperidine dihydrochloride
ZDA66999-02 0.5 g

1-Ethyl-4-hydrazinylpiperidine dihydrochloride

Sign In for Pricing
View Details
Lentiviral human KANSL2 shRNA (UAS) - Lentiviral human KANSL2 shRNA (UAS, iRFP) (100)
GTR15329106 1 Vial

Lentiviral human KANSL2 shRNA (UAS) - Lentiviral human KANSL2 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human Nuclear Receptor ROR-alpha (RORa) ELISA Kit
YLA4593HU-01 48 Tests

Human Nuclear Receptor ROR-alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
Human Nuclear Receptor ROR-alpha (RORa) ELISA Kit
YLA4593HU-02 96 Tests

Human Nuclear Receptor ROR-alpha (RORa) ELISA Kit

Sign In for Pricing
View Details
CSE 3'UTR Luciferase Stable Cell Line
TU005089 1.0 mL

CSE 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details