Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmF (msmF)

This Recombinant Multiple sugar-binding transport system permease protein msmF (msmF) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmF

UniProt

Q00750

Expression Region

1-290

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIRKVLNKYWGWTFLIVPLILQVVFFYFPMFQGAFYSFTNWTGLTYNFDFVGINNYKIL MTDGKFMKAIGFTLVLTLALIVGEIVLGIIIARALNAKIKGKTFFRAWFFFPAVLSGLTV SLIFKQVFNYGLPAVGSALGIKFLETSMLGTANGAVIASIFVLLWQGVAMPIILFLSGLQ SIPSEIVEAAAIDGADSKQTFWSVELPYLLPSISMVFIMALKAGLTAFDQIFALTGGGPN NSTTSLGLLVYNYAFKSNQYGYANAIALILFIIIGIVSVLQIKLSKKFEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR2 Rabbit Polyclonal Antibody (HRP)
orb2609665 100 µg

CCR2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Collagen Type III (COL3A1, Collagen alpha-1 (III) Chain) (AP) discontinued
125197-AP 100 µL

Collagen Type III (COL3A1, Collagen alpha-1 (III) Chain) (AP) discontinued

Sign In for Pricing
View Details
Hypertrehalosaemic Neuropeptide, Heliothis zea
E-PP-1359-01 10 mg

Hypertrehalosaemic Neuropeptide, Heliothis zea

Sign In for Pricing
View Details
Hypertrehalosaemic Neuropeptide, Heliothis zea
E-PP-1359-02 100 mg

Hypertrehalosaemic Neuropeptide, Heliothis zea

Sign In for Pricing
View Details
Hypertrehalosaemic Neuropeptide, Heliothis zea
E-PP-1359-03 5 mg

Hypertrehalosaemic Neuropeptide, Heliothis zea

Sign In for Pricing
View Details
GDC-0879
A5071-25 25 mg

GDC-0879

Sign In for Pricing
View Details