Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multiple sugar-binding transport system permease protein msmF (msmF)

This Recombinant Multiple sugar-binding transport system permease protein msmF (msmF) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Multiple sugar-binding transport system permease protein msmF

UniProt

Q00750

Expression Region

1-290

Origin

Streptococcus mutans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTIRKVLNKYWGWTFLIVPLILQVVFFYFPMFQGAFYSFTNWTGLTYNFDFVGINNYKIL MTDGKFMKAIGFTLVLTLALIVGEIVLGIIIARALNAKIKGKTFFRAWFFFPAVLSGLTV SLIFKQVFNYGLPAVGSALGIKFLETSMLGTANGAVIASIFVLLWQGVAMPIILFLSGLQ SIPSEIVEAAAIDGADSKQTFWSVELPYLLPSISMVFIMALKAGLTAFDQIFALTGGGPN NSTTSLGLLVYNYAFKSNQYGYANAIALILFIIIGIVSVLQIKLSKKFEV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Euphorbia factor L7a
M31349-01 100 mg

Euphorbia factor L7a

Sign In for Pricing
View Details
Euphorbia factor L7a
M31349-02 500 mg

Euphorbia factor L7a

Sign In for Pricing
View Details
Euphorbia factor L7a
M31349-03 Inquire

Euphorbia factor L7a

Sign In for Pricing
View Details
Euphorbia factor L7a
M31349-04 5 mg

Euphorbia factor L7a

Sign In for Pricing
View Details
Euphorbia factor L7a
M31349-05 10 mg

Euphorbia factor L7a

Sign In for Pricing
View Details
ZDHHC24 Antibody (C-term)
MBS9204555-01 0.08 mL

ZDHHC24 Antibody (C-term)

Sign In for Pricing
View Details