Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P0AGK2

Expression Region

1-290

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK2 (MAPK1) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6H3]
AM00086PU-N 100 µg

ERK2 (MAPK1) (N-term) (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 6H3]

Sign In for Pricing
View Details
TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL
BNC683177-100 1x 100 µL

TAG-72 / CA72.4 (Tumor-Associated Glycoprotein) (rB72.3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lupiwighteone
TRC-L478020-5MG 5 mg

Lupiwighteone

Sign In for Pricing
View Details
MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF647 conjugate, 0.1mg/mL
BNC473048-500 1x 500 µL

MCAM (Melanoma Cell Adhesion Molecule) / MUC18 / CD146 (MCAM/3048), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bbs2 Mouse Gene Knockout Kit (CRISPR)
KN501998 1 Kit

Bbs2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
BIK Human Gene Knockout Kit (CRISPR)
KN400546 1 Kit

BIK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details