Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA)

This Recombinant 4-hydroxybenzoate octaprenyltransferase (ubiA) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

4-hydroxybenzoate octaprenyltransferase, EC= 2.5.1.-, 4-HB polyprenyltransferase

UniProt

P0AGK2

Expression Region

1-290

Origin

Escherichia coli O6

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEWSLTQNKLLAFHRLMRTDKPIGALLLLWPTLWALWVATPGVPQLWILAVFVAGVWLMR AAGCVVNDYADRKFDGHVKRTANRPLPSGAVTEKEARALFVVLVLISFLLVLTLNTMTIL LSIAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAAVSESVPLSCWLMFLANILWA VAYDTQYAMVDRDDDVKIGIKSTAILFGQYDKLIIGILQIGVLALMAIIGELNGLGWGYY WSILVAGALFVYQQKLIANREREACFKAFMNNNYVGLVLFLGLAMSYWHF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LIN28B (NM_001004317) Human Over-expression Lysate
LY424091 100 µg

LIN28B (NM_001004317) Human Over-expression Lysate

Sign In for Pricing
View Details
Apoa2 Mouse Gene Knockout Kit (CRISPR)
KN501408 1 Kit

Apoa2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HOMER3 Rabbit Polyclonal Antibody
AP17478PU-N 400 µL

HOMER3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Semaphorin 3c (SEMA3C) (NM_006379) Human Over-expression Lysate
LC401916 20 µg

Semaphorin 3c (SEMA3C) (NM_006379) Human Over-expression Lysate

Sign In for Pricing
View Details
PRDX3 Antibody
KC-30612-01 50 μL

PRDX3 Antibody

Sign In for Pricing
View Details
PRDX3 Antibody
KC-30612-02 100 µL

PRDX3 Antibody

Sign In for Pricing
View Details