Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P45794

Expression Region

1-290

Origin

Aeromonas hydrophila

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFNPDDEGV DEPPYNLMVPRSCCPHCNHPITALENIPLLSWLWLRGRCRGCQAPISARYPLVELLTALL SVAVAMTLAPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGFVS LGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSSL VGAFMGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLTNFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-c-RET Antibody (Regeneron patent anti-RET)
F1573-1 1 mg

Anti-c-RET Antibody (Regeneron patent anti-RET)

Sign In for Pricing
View Details
BRD2 Recombinant Antibody, RBITC Conjugated
bsm-54434R-RBITC-01 20 µL

BRD2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
BRD2 Recombinant Antibody, RBITC Conjugated
bsm-54434R-RBITC-02 100 µL

BRD2 Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PTBP1 Human Over-expression Lysate
orb1345198 100 µg

PTBP1 Human Over-expression Lysate

Sign In for Pricing
View Details
ISY1 HDR Plasmid (h)
sc-416434-HDR 20 µg

ISY1 HDR Plasmid (h)

Sign In for Pricing
View Details
LYRM2 ORF Vector (Human) (pORF)
27849011 1.0 µg DNA

LYRM2 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details