Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD)

This Recombinant Type 4 prepilin-like proteins leader peptide-processing enzyme (tapD) spans the amino acid sequence from region 1-290.

Product Specifications

Product Name Alternative

Type 4 prepilin-like proteins leader peptide-processing enzyme, Including the following 2 domains:, Leader peptidase, EC= 3.4.23.43, Prepilin peptidase, N-methyltransferase, EC= 2.1.1.-

UniProt

P45794

Expression Region

1-290

Origin

Aeromonas hydrophila

Field of Research

Protein Biochemistry

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLLELAHGLPWLYFSLVFLFSLMIGSFLNVVIHRLPIMLEREWQAEYRSYFNPDDEGV DEPPYNLMVPRSCCPHCNHPITALENIPLLSWLWLRGRCRGCQAPISARYPLVELLTALL SVAVAMTLAPGWGTLAALLLTWVLVALTFIDLDKMLLPDQLTLPLLWGGLLFNLLGGFVS LGDAVIGAMAGYLVLWSLYWAFKLLTGKEGMGYGDFKLLAALGAWLGWQALPIVLLLSSL VGAFMGIGLILLRNHHQSKPIPFGPYLAIAGWIALLWGDSITRWYLTNFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VX-150
S1335-25mg 25 mg

VX-150

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)
MBS1048726-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)
MBS1048726-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)
MBS1048726-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)
MBS1048726-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)
MBS1048726-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Uncharacterized but2-like protein C27D7.09c (SPAC27D7.09c, SPAC27D7.10c)

Sign In for Pricing
View Details