Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Papio hamadryas Taste receptor type 2 member 16 (TAS2R16)

This Recombinant Papio hamadryas Taste receptor type 2 member 16 (TAS2R16) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 16, T2R16

UniProt

Q646E7

Expression Region

1-291

Origin

Papio hamadryas (Hamadryas baboon)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIPIQLSVFFMIIYVLESLTIIVQSSLIVAVLGREWLQIRRLMPVDMILISLGISRFCLQ WTSMLNDFCFYFNFNYVLCNLTITWTFFNVLTFWLNSLLTVFYCIKVSSFTHPIVLWLRW RILRWLPWLLLGCLMITCVTIIPSAIGNYIQIQFLTMEHPPRNSTVIDRLQKFHQYLHQA HTVALVIPFILFLASTILLMASLTKQIQHHGTGHCNPSMKAHFTALRSLAILFIVFTSYF LTILITMIGTLFDKRCWLWVWEAFVYAFIFMHSTSLMLSSPTLKRILNGKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD46 (122.2), CF594 conjugate, 0.1mg/mL
BNC940175-100 1x 100 µL

CD46 (122.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL
BNC400634-100 1x 100 µL

CD146 / MCAM / MUC18 / Mucin 18 (C146/634), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (6E1.), CF740 conjugate, 0.1mg/mL
BNC740051-100 1x 100 µL

Thyroglobulin (6E1.), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF594 conjugate, 0.1mg/mL
BNC941462-100 1x 100 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (ENO2/1462), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF647 conjugate, 0.1mg/mL
BNC472220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P57 / KIP2 (KIP2/880), CF488A conjugate, 0.1mg/mL
BNC880880-500 1x 500 µL

P57 / KIP2 (KIP2/880), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details