Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PQ-loop repeat-containing protein 2 (PQLC2)

This Recombinant Human PQ-loop repeat-containing protein 2 (PQLC2) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q6ZP29

Expression Region

1-291

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKA YKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYK FRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQ EVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNTLYGLSVLLKNPE EGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEPLLPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Itpripl2 Polyclonal Antibody
CAC11707-01 50 µL

Itpripl2 Polyclonal Antibody

Sign In for Pricing
View Details
Itpripl2 Polyclonal Antibody
CAC11707-02 100 µL

Itpripl2 Polyclonal Antibody

Sign In for Pricing
View Details
NPHS1 Human Pre-designed siRNA Set A
HY-RS09486 1 Set

NPHS1 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit
abx530573-01 96 Tests

Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit
abx530573-02 5x 96 Tests

Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit

Sign In for Pricing
View Details
Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit
abx530573-03 10x 96 Tests

Mouse Keratinocyte differentiation-associated protein (KRTDAP) ELISA Kit

Sign In for Pricing
View Details