Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human PQ-loop repeat-containing protein 2 (PQLC2)

This Recombinant Human PQ-loop repeat-containing protein 2 (PQLC2) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q6ZP29

Expression Region

1-291

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWKKLGSRNFSSCPSGSIQWIWDVLGECAQDGWDEASVGLGLISILCFAASTFPQFIKA YKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLVMLTLYFYYK FRTRPSLLSAPINSVLLFLMGMACATPLLSAAGPVAAPREAFRGRALLSVESGSKPFTRQ EVIGFVIGSISSVLYLLSRLPQIRTNFLRKSTQGISYSLFALVMLGNTLYGLSVLLKNPE EGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRRSTAASELEPLLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XKRY (NM_004677) Human Tagged ORF Clone Lentiviral Particle
RC214096L3V 200 µL

XKRY (NM_004677) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse APOB (Apolipoprotein B) ELISA Kit
MBS8822464-01 48 Well

Mouse APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Mouse APOB (Apolipoprotein B) ELISA Kit
MBS8822464-02 96 Well

Mouse APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Mouse APOB (Apolipoprotein B) ELISA Kit
MBS8822464-03 5x 96 Well

Mouse APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
Mouse APOB (Apolipoprotein B) ELISA Kit
MBS8822464-04 10x 96 Well

Mouse APOB (Apolipoprotein B) ELISA Kit

Sign In for Pricing
View Details
OLFR644 Adenovirus (Mouse)
33328054 1.0 mL

OLFR644 Adenovirus (Mouse)

Sign In for Pricing
View Details