Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine RPE-retinal G protein-coupled receptor (RGR)

This Recombinant Bovine RPE-retinal G protein-coupled receptor (RGR) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

RPE-retinal G protein-coupled receptor

UniProt

P47803

Expression Region

1-291

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAESGTLPTGFGELEVLAVGTVLLVEALSGLSLNILTILSFCKTPELRTPSHLLVLSLAL ADSGISLNALVAATSSLLRRWPYGSEGCQAHGFQGFVTALASICSSAAVAWGRYHHFCTR SRLDWNTAVSLVFFVWLSSAFWAALPLLGWGHYDYEPLGTCCTLDYSRGDRNFTSFLFTM AFFNFLLPLFITVVSYRLMEQKLGKTSRPPVNTVLPARTLLLGWGPYALLYLYATIADAT SISPKLQMVPALIAKAVPTVNAMNYALGSEMVHRGIWQCLSPQRREHSREQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL
BNC942853-500 1x 500 µL

CD54 / ICAM-1 (15.2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL
BNC680304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF568 conjugate, 0.1mg/mL
BNC680345-100 1x 100 µL

CD4 (EDU-2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL
BNC940352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL
BNC680429-500 1x 500 µL

CD19 (CVID3/429), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details