Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB)

This Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2I0Z6

Expression Region

1-291

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGFTAIHLDSMGWSIGLG VIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGKSRLIAPLALTIFVWIF LMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPSTDPNITLGMSLSVFVLILFYS IREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFLARPISLALRLFGNMYAGE LIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTIVYLSMASEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS6ST1 (Heparan Sulfate 6-O-Sulfotransferase 1, DKFZp547H098, FLJ25392, HS6ST, MGC116899, MGC116901)
247259 100 µg

HS6ST1 (Heparan Sulfate 6-O-Sulfotransferase 1, DKFZp547H098, FLJ25392, HS6ST, MGC116899, MGC116901)

Sign In for Pricing
View Details
HCT-8 Cell Specific Culture Medium
C110715 4x 125 mL

HCT-8 Cell Specific Culture Medium

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)
orb2920123-01 20 µg

Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)

Sign In for Pricing
View Details
Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)
orb2920123-02 100 µg

Recombinant Pseudomonas aeruginosa Disulfide bond formation protein B 2 (dsbB2)

Sign In for Pricing
View Details
Lentiviral mouse Lsm5 shRNA (UAS) - Lentiviral mouse Lsm5 shRNA (UAS) (100)
GTR15248526 1 Vial

Lentiviral mouse Lsm5 shRNA (UAS) - Lentiviral mouse Lsm5 shRNA (UAS) (100)

Sign In for Pricing
View Details
YY1 (Yin and Yang 1, YY-1, Transcriptional Repressor Protein YY1, Delta Transcription Factor, INO80 Complex Subunit S, INO80S, NF-E1)
135492 100 µg

YY1 (Yin and Yang 1, YY-1, Transcriptional Repressor Protein YY1, Delta Transcription Factor, INO80 Complex Subunit S, INO80S, NF-E1)

Sign In for Pricing
View Details