Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB)

This Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2I0Z6

Expression Region

1-291

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGFTAIHLDSMGWSIGLG VIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGKSRLIAPLALTIFVWIF LMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPSTDPNITLGMSLSVFVLILFYS IREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFLARPISLALRLFGNMYAGE LIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTIVYLSMASEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SHP 1, Recombinant, Human (SHPTP-1, SH2 containing protein tyrosine phosphatase 1, PTP1C, SH-PP1, HCP, SHP, PTPN6)
MBS635656-01 0.02 mg

SHP 1, Recombinant, Human (SHPTP-1, SH2 containing protein tyrosine phosphatase 1, PTP1C, SH-PP1, HCP, SHP, PTPN6)

Sign In for Pricing
View Details
SHP 1, Recombinant, Human (SHPTP-1, SH2 containing protein tyrosine phosphatase 1, PTP1C, SH-PP1, HCP, SHP, PTPN6)
MBS635656-02 5x 0.02 mg

SHP 1, Recombinant, Human (SHPTP-1, SH2 containing protein tyrosine phosphatase 1, PTP1C, SH-PP1, HCP, SHP, PTPN6)

Sign In for Pricing
View Details
RNY4P7 Protein Vector (Human) (pPM-C-HA)
40656021 500 ng

RNY4P7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Tricyclic Antidepressants antibody
10-T55B 1 mg

Tricyclic Antidepressants antibody

Sign In for Pricing
View Details
1,4-Diiodobutane
411336-01 10 g

1,4-Diiodobutane

Sign In for Pricing
View Details
1,4-Diiodobutane
411336-02 25 g

1,4-Diiodobutane

Sign In for Pricing
View Details