Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB)

This Recombinant Acinetobacter baumannii ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

B2I0Z6

Expression Region

1-291

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAEEHALTSTEYIKHHLTNMTYGKMPDGTWKLAETAEEAHSMGFTAIHLDSMGWSIGLG VIFCLLFWIVARAANAGVPTKFQSAIEMIIEFVDSSVRDTFHGKSRLIAPLALTIFVWIF LMNLMDLIPVDWIPQVAAFVGANVFGMDPHHVYFKIVPSTDPNITLGMSLSVFVLILFYS IREKGVGGFVGELALNPFNPSNPVAKALLIPVNLILELVTFLARPISLALRLFGNMYAGE LIFILIALLPFWIQWALSVPWAIFHILVITLQAFIFMMLTIVYLSMASEKH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RUNX1
FP-338 100 µL - 10 Tests

RUNX1

Sign In for Pricing
View Details
STK11IP Rabbit pAb, Pacific Blue conjugated
orb2850432 100 µL

STK11IP Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Mouse CD62P ELISA Kit
MBS824650-01 96 Tests

Mouse CD62P ELISA Kit

Sign In for Pricing
View Details
Mouse CD62P ELISA Kit
MBS824650-02 5x 96 Tests

Mouse CD62P ELISA Kit

Sign In for Pricing
View Details
Recombinant Human PTGER3 Protein, N-His
HW321012-01 50 µg

Recombinant Human PTGER3 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human PTGER3 Protein, N-His
HW321012-02 100 µg

Recombinant Human PTGER3 Protein, N-His

Sign In for Pricing
View Details