Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Rhodobacter sphaeroides Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-292.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

A4WP56

Expression Region

1-292

Origin

Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYIPFPDISPEIFSVELFGATFALRWYALAYIAGLLIGWRLVLRMIRSDRLWTFGAPMT EDQLERLLTWVILGVILGGRLGFVLFYQPSHYLAHPLDALKVWEGGMSFHGGFLGVMVAV IAFCLRERISILPVADLLAAATPPGLFLGRIANFINAELWGRPTTLPWGVAFPGEAAQTC PGIEGICARHPSQLYEAALEGIVLFAILAILIWRRGWLRWPGAVTGAFLAGYGCARFLVE FVRQPDAQFVTPGNPLGLAWEIGGYGLTMGQILSLPMILLGLYFMLRARRTA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL
BNC400012-500 1x 500 µL

Tyrosinase (T311), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 (CD30/412), CF405S conjugate, 0.1mg/mL
BNC040412-500 1x 500 µL

CD30 (CD30/412), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8b, Mouse (H35-17.2), CF647 conjugate, 0.1mg/mL
BNC472003-100 1x 100 µL

CD8b, Mouse (H35-17.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL
BNC680812-500 1x 500 µL

Tyrosinase (OCA1/812), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details