Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Probable metal transport system membrane protein CT_417 (CT_417)

This Recombinant Chlamydia trachomatis Probable metal transport system membrane protein CT_417 (CT_417) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

Probable metal transport system membrane protein CT_417

UniProt

O84422

Expression Region

1-293

Origin

Chlamydia trachomatis (strain D/UW-3/Cx)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMISILCSLFPPLLFPSLLAAFGASIAAGIIGSYIVVKRIVSISGSIAHSILGGVGIAL WLQYQFNLPISPLHGAIASAIFVAICIGNVHLKYHEREDSIISMIWSIGMAIGIICISKL PSFNSELSDFLFGNILWVTPQDLYFLGILDLFIVATVSICHTRFLALCFDEKYMALNHYS IKTWYLLLLILTAITTVVLMYVMGVILMLSMLVLPVSIACRFSYKMSHIIYIASILNIVC SFLGIMLAYLLDLPVGPVIAILMGGAYSLSLLLKRSYNASTPSPVSPESKINS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N1,N3,N5-tris(3-(Didodecylamino)propyl)benzene-1,3,5-tricarboxamide
TRC-D181250-100MG 100 mg

N1,N3,N5-tris(3-(Didodecylamino)propyl)benzene-1,3,5-tricarboxamide

Sign In for Pricing
View Details
PAR4 (PAWR) Mouse Monoclonal Antibody [Clone ID: 3G9H7]
AM06234SU-N 100 µL

PAR4 (PAWR) Mouse Monoclonal Antibody [Clone ID: 3G9H7]

Sign In for Pricing
View Details
Chloroform (Anhydrous) Contains Amylenes as stabilizer
TRC-C366491-250ML 250 mL

Chloroform (Anhydrous) Contains Amylenes as stabilizer

Sign In for Pricing
View Details
SEC13L1 (SEC13) (NM_001136232) Human Over-expression Lysate
LY427864 100 µg

SEC13L1 (SEC13) (NM_001136232) Human Over-expression Lysate

Sign In for Pricing
View Details
IgA Secretory Component (SC05), 0.2mg/mL
BNUB0050-100 1x 100 µL

IgA Secretory Component (SC05), 0.2mg/mL

Sign In for Pricing
View Details
Mouse Kdf1 activation kit by CRISPRa
GA208044 1 Kit

Mouse Kdf1 activation kit by CRISPRa

Sign In for Pricing
View Details