Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2)

This Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q8C4N4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWRTLGASNFSTCPNGSVQWIWDVFGECAQDGWDEASVGLGLVSILCFAASTFPQYIKA CKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLMMLTLYFHYK FKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLSVEPGNKPFTKK EVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNTLYGLSVLLKNPE VGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRSHETAAASEREPLLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT1 Rabbit Polyclonal Antibody
orb574630 100 µL

STAT1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Formaldehyde diisopropyl acetal
OR1043111-01 100 mg

Formaldehyde diisopropyl acetal

Sign In for Pricing
View Details
Formaldehyde diisopropyl acetal
OR1043111-02 250 mg

Formaldehyde diisopropyl acetal

Sign In for Pricing
View Details
Formaldehyde diisopropyl acetal
OR1043111-03 1 g

Formaldehyde diisopropyl acetal

Sign In for Pricing
View Details
Formaldehyde diisopropyl acetal
OR1043111-04 5 g

Formaldehyde diisopropyl acetal

Sign In for Pricing
View Details
Rubicon Antibody: ATTO 390
MBS809905-01 0.1 mg

Rubicon Antibody: ATTO 390

Sign In for Pricing
View Details