Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2)

This Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q8C4N4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWRTLGASNFSTCPNGSVQWIWDVFGECAQDGWDEASVGLGLVSILCFAASTFPQYIKA CKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLMMLTLYFHYK FKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLSVEPGNKPFTKK EVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNTLYGLSVLLKNPE VGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRSHETAAASEREPLLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRR16 (NM_001300783) Human Tagged ORF Clone
RG237327 10 µg

PRR16 (NM_001300783) Human Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-POLR2A CTD-S2 Rabbit mAb
AP0996-01 20 µL

Phospho-POLR2A CTD-S2 Rabbit mAb

Sign In for Pricing
View Details
Phospho-POLR2A CTD-S2 Rabbit mAb
AP0996-02 100 μL

Phospho-POLR2A CTD-S2 Rabbit mAb

Sign In for Pricing
View Details
Phospho-POLR2A CTD-S2 Rabbit mAb
AP0996-03 500 μL

Phospho-POLR2A CTD-S2 Rabbit mAb

Sign In for Pricing
View Details
Phospho-POLR2A CTD-S2 Rabbit mAb
AP0996-04 1000 μL

Phospho-POLR2A CTD-S2 Rabbit mAb

Sign In for Pricing
View Details
Inhibin beta A Polyclonal Antibody, Cy5 Conjugated
bs-1774R-Cy5 100 µL

Inhibin beta A Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details