Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2)

This Recombinant Mouse PQ-loop repeat-containing protein 2 (Pqlc2) spans the amino acid sequence from region 1-293.

Product Specifications

Product Name Alternative

PQ-loop repeat-containing protein 2

UniProt

Q8C4N4

Expression Region

1-293

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVWRTLGASNFSTCPNGSVQWIWDVFGECAQDGWDEASVGLGLVSILCFAASTFPQYIKA CKTGNMDQALSLWFLLGWIGGDSCNLIGSFLADQLPLQTYTAVYYVLADLMMLTLYFHYK FKKRPSPLSAPINSVLLFILGTVCITPLLSSTDPVAVPREGFRGRTLLSVEPGNKPFTKK EVIGFVIGSASSLLYLLSRLPQIRTNFIRQSTQGISYSLFALVMLGNTLYGLSVLLKNPE VGQSEGSYLLHHLPWLVGSLGVLLLDTIISIQFLVYRSHETAAASEREPLLPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SV2A (NM_014849) Human Over-expression Lysate
E45H09391-2 20 µg

SV2A (NM_014849) Human Over-expression Lysate

Sign In for Pricing
View Details
Human endothelial protein C receptor (EPCR) ELISA Kit
201-12-5858 96 Tests

Human endothelial protein C receptor (EPCR) ELISA Kit

Sign In for Pricing
View Details
CTSL Protein Lysate
OCOA05935-20UG 20 µg

CTSL Protein Lysate

Sign In for Pricing
View Details
Human Zinc Finger Protein 324A (ZNF324) ELISA Kit
abx553914 96 Tests

Human Zinc Finger Protein 324A (ZNF324) ELISA Kit

Sign In for Pricing
View Details
Food DNA Extraction Kit I (50 prep)
FDK-1050 50 Preparations

Food DNA Extraction Kit I (50 prep)

Sign In for Pricing
View Details
PP2A alpha + beta (11F10) Monoclonal Antibody
bsm-52611R 100 µL

PP2A alpha + beta (11F10) Monoclonal Antibody

Sign In for Pricing
View Details