Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Haemophilus influenzae Dipeptide transport system permease protein dppC (dppC)

This Recombinant Haemophilus influenzae Dipeptide transport system permease protein dppC (dppC) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Dipeptide transport system permease protein dppC

UniProt

P51000

Expression Region

1-295

Origin

Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDTPLTFAPKTPLQEFWFYFKQNRGALIGLIFILIVALISILAPYIAPFDPTEQNRTAL LLPPAWYEGGNPAYLLGTDDIGRDILSRIIYGTRISVFAGFIIVLLSCAFGTSLGLISGY YGGVLDTIIIRLIDIMLAIPNLLLTIVVVSILEPSLANATLAIAVVSIPSYVRLTRAAMM NEKNRDYVTSSKVAGAGILRLMFIVILPNCLAPLIVQMTMGISNAILELATLGFLGIGAK PPTPELGTMLSEARGFMQAANWLVTIPGLVILSLVLAFNLMGDGLRDALDPKLKQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL
BNC470352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF647 conjugate, 0.1mg/mL
BNC470861-500 1x 500 µL

HSP27 (G3.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL
BNC801037-500 1x 500 µL

CD44 Standard (DF1485), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL
BNC472205-100 1x 100 µL

PGP9.5 / UchL1 (pan-Neuronal Marker) (rUCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), 1mg/mL
BNUM0304-50 1x 50 µL

CD106 / VCAM1 (B-K9), 1mg/mL

Sign In for Pricing
View Details