Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanothermobacter thermautotrophicus Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

O27231

Expression Region

1-295

Origin

Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) (Methanobacterium thermoautotrophicum)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG EPVAYGTWCGIAGSVAYVLMQSMQLPVIMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQF NQPLFMDMLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEDE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Longfin inshore squid FMRP Rabbit Polyclonal Antibody (Cy3)
orb2570068 200 µL

Longfin inshore squid FMRP Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
Recombinant Human Parathyroid Hormone/PTH (N-8His)
CB42-10ug 10 µg

Recombinant Human Parathyroid Hormone/PTH (N-8His)

Sign In for Pricing
View Details
ABCA7 Double Nickase Plasmid (m2)
sc-424270-NIC-2 20 µg

ABCA7 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Ermin Rabbit Polyclonal Antibody (Cy5.5)
orb1065737 100 µL

Ermin Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
FNTB Antibody
orb673430-01 50 µg

FNTB Antibody

Sign In for Pricing
View Details
FNTB Antibody
orb673430-02 100 µg

FNTB Antibody

Sign In for Pricing
View Details