Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Frankia sp. ATP synthase subunit a (atpB)

This Recombinant Frankia sp. ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

A8L3V9

Expression Region

1-295

Origin

Frankia sp. (strain EAN1pec)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPSGSVLMAADDGFHGPTPDVFKPKSWFEFDLGPIDFYFNKWSALTLFVALFVGGFLWLG FRKATLVPRGLQNFCESIYDFVDLQIAQNVIGERGRTFSPYLTILFCFILVSNVMAVIPV AQFPTTSRIALPMILAAVSWFIFNIVGIREHGAGTYFKDMLVPAPTAPLFVKVILAPIEF VSTMIARPATLAIRLFANMFAGHMLLLVFALGADYLLPKPQFVFGLVSGLMAIALTLFEL MIDVLQAYIFTVLTAAYIGGAISSHGGGDHAADHSPIHGHETSAPVTAAGAVARA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Liver
CS622236 5x 5 µm

Frozen Tissue Sections, Liver

Sign In for Pricing
View Details
Human CSGALNACT1 activation kit by CRISPRa
GA110972 1 Kit

Human CSGALNACT1 activation kit by CRISPRa

Sign In for Pricing
View Details
Cinnamyl Alcohol
TRC-C442110-50G 50 g

Cinnamyl Alcohol

Sign In for Pricing
View Details
Tissue Total RNA, Soft tissue
CR559307 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
3-Ethyl Adenine-d5 (2% d0)
TRC-E897150-1MG 1 mg

3-Ethyl Adenine-d5 (2% d0)

Sign In for Pricing
View Details
2-Bromo-1-cyclopropyl-2-(4-fluorophenyl)ethanone
TRC-B682785-50MG 50 mg

2-Bromo-1-cyclopropyl-2-(4-fluorophenyl)ethanone

Sign In for Pricing
View Details