Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanothermobacter marburgensis Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-295.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

P80186

Expression Region

1-295

Origin

Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) (Methanobacterium thermoautotrophicum)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDPMITGLGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSG EPVAYGTWCGIAGSVAFVLMNSMQLPVIMAIAIGAVIAAMVHTTYAVTSHMGRIVSQSQF NQPLFMDMLVQHLGPIAGHGFIVTFCTVGLSYLMTLPIPGFAHPFPLPLLAVLWGITIGA IGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTG FAFGAIVFLSFWNTIVFGITGGIISGLIIVLLLIILNNRLEVFARNRYGPYKEEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Sgcz Pre-designed siRNA Set A
SI112815A 1 Each

Mouse Sgcz Pre-designed siRNA Set A

Sign In for Pricing
View Details
Rabbit Polyclonal ERp72 Antibody
NBP3-27898 0.1 mg

Rabbit Polyclonal ERp72 Antibody

Sign In for Pricing
View Details
Atp2b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6834706 1.0 µg DNA

Atp2b3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Human Apolipoprotein A4 (APOA4) Protein
abx167095-01 10 µg

Human Apolipoprotein A4 (APOA4) Protein

Sign In for Pricing
View Details
Human Apolipoprotein A4 (APOA4) Protein
abx167095-02 50 µg

Human Apolipoprotein A4 (APOA4) Protein

Sign In for Pricing
View Details
Human Apolipoprotein A4 (APOA4) Protein
abx167095-03 100 µg

Human Apolipoprotein A4 (APOA4) Protein

Sign In for Pricing
View Details