Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0761 membrane protein YE0031 (YE0031)

This Recombinant Yersinia enterocolitica serotype O:8 / biotype 1B UPF0761 membrane protein YE0031 (YE0031) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

UPF0761 membrane protein YE0031

UniProt

A1JHU3

Expression Region

1-296

Origin

Yersinia enterocolitica serotype O:8 / biotype 1B (strain 8081)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASFLRFRLSASLKPYITFGRMLYTRIDKDGLTMLAGHLAYVSLLSLVPLVTVIFALFAA FPMFADISIKLKAFIFTNFMPATGDIIQNYLEQFVANSNRMTVVGTCGLIVTALLLIYSV DSVLNIIWRSKVHRSLVFSFAVYWMVLTLGPILVGASMVISSYLLSLQWLANARVDSMID ETLRLFPLLISWVSFWLLYSVVPTVRVPAQDALIGALVAALFFELGKKGFTMYITLFPSY QLIYGVLAVIPILFLWVYWSWCIVLLGAEITVTLGEYRAQRHQAITEKSPSQSQEI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL
BNC882540-100 1x 100 µL

SOX4 (Master Regulator of Epithelial-Mesenchymal Transition) (SOX4/2540), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF568 conjugate, 0.1mg/mL
BNC681188-500 1x 500 µL

SUMO-1 (SUMO1/1188), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF647 conjugate, 0.1mg/mL
BNC470743-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4 + E29), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL
BNC880675-100 1x 100 µL

Cytokeratin 6 (LHK6), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL
BNC472174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL
BNC041718-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (BCL6/1718), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details