Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus carnosus Undecaprenyl-diphosphatase (uppP)

This Recombinant Staphylococcus carnosus Undecaprenyl-diphosphatase (uppP) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Undecaprenyl-diphosphatase, EC= 3.6.1.27, Bacitracin resistance protein, Undecaprenyl pyrophosphate phosphatase

UniProt

B9DK59

Expression Region

1-296

Origin

Staphylococcus carnosus (strain TM300)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLLELLKALILGIVEGLTEFAPVSSTGHMILVDDMWLKSPEFLGSQSAFTFKIVIQLGS VFAAAWVFRKRYFEMLYIGKYQPAATETESADGKIGKRVKPKRLTLWHVLVGMIPAGILG LLFDDVIEKYLFSVPTVMIGLLLGAFYMIFAQKFSERYAHRENIDQITFFQAFVIGLSQA VAMWPGFSRSGSTISTGVLMKMNYKAASDFTFIMAVPIMLAASLLSLVKHIGYIHLSHIP FYIIGFLAAFIFGLLSIRLFLNLINRIKLIPFAIYRIILVIFIAILYFGFGIGKGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rnf34 Mouse Gene Knockout Kit (CRISPR)
KN514950 1 Kit

Rnf34 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DUSP8 (C-term) Rabbit Polyclonal Antibody
AP15269PU-N 400 µL

DUSP8 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CAB39 Recombinant Rabbit monoclonal Antibody
HA723720 100 µL

CAB39 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
C9orf169 (CYSRT1) Human qPCR Primer Pair (NM_199001)
HP219465 200 Reactions

C9orf169 (CYSRT1) Human qPCR Primer Pair (NM_199001)

Sign In for Pricing
View Details
MTG16 Antibody
8C10912-AAT 50 µg

MTG16 Antibody

Sign In for Pricing
View Details
CITED2 Rabbit Polyclonal Antibody
TA374817 100 µL

CITED2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details