Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 24-319.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A7YWP2

Expression Region

24-319

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQE GQKVPQFHGKWPFSRFLCFQEPASAVASFLNGLASLVMLCRYRTSVPASSPMYPTCVAFA WVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAMASAFRALL LLLLTAHVSYLSLIHFDYGYNMAANVAIGLLNAAWWLAWCLWNQRLPHVHKCVAVVLLLQ GLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEAKVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pon1 (NM_032077) Rat Tagged Lenti ORF Clone
RR215625L3 10 µg

Pon1 (NM_032077) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)
MBS964826-01 0.02 mg (E-Coli)

Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)
MBS964826-02 0.02 mg (Yeast)

Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)
MBS964826-03 0.1 mg (E-Coli)

Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)
MBS964826-04 0.1 mg (Yeast)

Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)

Sign In for Pricing
View Details
Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)
MBS964826-05 0.02 mg (Baculovirus)

Recombinant Human General transcription factor IIF subunit 1 (GTF2F1)

Sign In for Pricing
View Details