Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 24-319.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A7YWP2

Expression Region

24-319

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQE GQKVPQFHGKWPFSRFLCFQEPASAVASFLNGLASLVMLCRYRTSVPASSPMYPTCVAFA WVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAMASAFRALL LLLLTAHVSYLSLIHFDYGYNMAANVAIGLLNAAWWLAWCLWNQRLPHVHKCVAVVLLLQ GLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEAKVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GJB3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV672504 1.0 µg DNA

GJB3 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Canine CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit
GTR10362923 96 Well

Canine CCAAT/enhancer binding protein epsilon, C/EBPε ELISA Kit

Sign In for Pricing
View Details
Human CNP/2', 3'-cyclic-nucleotide 3'-phosphodiesterase ELISA Kit
E0515Hu 96 Tests

Human CNP/2', 3'-cyclic-nucleotide 3'-phosphodiesterase ELISA Kit

Sign In for Pricing
View Details
THTPA Antibody, Biotin conjugated
A70012-100UG 100 µg

THTPA Antibody, Biotin conjugated

Sign In for Pricing
View Details
Mouse NMNAT1 (NMN adenylyl transferase 1) ELISA Kit
EM1518 96 Tests

Mouse NMNAT1 (NMN adenylyl transferase 1) ELISA Kit

Sign In for Pricing
View Details
CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: LBI4G1]
AMM21018VCF 100 µg

CD137 (TNFRSF9) Mouse Monoclonal Antibody [Clone ID: LBI4G1]

Sign In for Pricing
View Details