Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3)

This Recombinant Bovine Post-GPI attachment to proteins factor 3 (PGAP3) spans the amino acid sequence from region 24-319.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A7YWP2

Expression Region

24-319

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DREPVYRDCVLRCEERNCSGGALKHFRSRQPIYMSLAGWTCRDDCKYECMWVTVGLYLQE GQKVPQFHGKWPFSRFLCFQEPASAVASFLNGLASLVMLCRYRTSVPASSPMYPTCVAFA WVSLNAWFWSTVFHTRDTDLTEKMDYFCASTVILHSIYLCCVRTVGLQHPAMASAFRALL LLLLTAHVSYLSLIHFDYGYNMAANVAIGLLNAAWWLAWCLWNQRLPHVHKCVAVVLLLQ GLSLLELLDFPPLFWVLDAHAIWHISTIPVHVLFFSFLEDDSLYLLKESEAKVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDRG2 (NM_201541) Human Recombinant Protein
TP310598 20 µg

NDRG2 (NM_201541) Human Recombinant Protein

Sign In for Pricing
View Details
PI 3-kinase p110δ Lentiviral Activation Particles (m)
sc-422232-LAC 200 µL

PI 3-kinase p110δ Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Slc36a1 (NM_130415) Rat Tagged ORF Clone
RR203887 10 µg

Slc36a1 (NM_130415) Rat Tagged ORF Clone

Sign In for Pricing
View Details
LIPI Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
26876066 1.0 µg DNA

LIPI Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Taxilin Alpha (TXLNa) Antibody Pair Kit (with Standard)
MBS2100005-01 5x 96 Tests

Mouse Taxilin Alpha (TXLNa) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Taxilin Alpha (TXLNa) Antibody Pair Kit (with Standard)
MBS2100005-02 5x 96 Tests + MBS2090685 (Ab Pairs Support Pack 1,5x 96 Tests)

Mouse Taxilin Alpha (TXLNa) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details