Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saccharomyces cerevisiae Protein RTC2 (RTC2)

This Recombinant Saccharomyces cerevisiae Protein RTC2 (RTC2) spans the amino acid sequence from region 1-296.

Product Specifications

Product Name Alternative

Protein RTC2, Restriction of telomere capping protein 2

UniProt

P38279

Expression Region

1-296

Origin

Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLIPIILNAKNLSGMAGSISICCWIVVFVPQIYENFRRQSAEGLSLLFIVLWLLGDIFN VMGAMMQNLLPTMIILAAYYTLADLILLIQCMWYDKEKKSILQEVKKNVDPVHLPPANPI NETVLQDVFNEYEPLLPRIEEEDSQSYSSLELGRTIVVKERENFFNDFLIVSGVLIAGIL SWYISYCSGLDNGIPKKKPAFEQINLPAQILGYLSAILYLGSRIPQIVLNFKRKSCEGVS FLFFLFACLGNTSFIISVLSASWLIGSAGTLLMDFTVFIQFFLYAKPKYEKILIDN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn2r58 Double Nickase Plasmid (m2)
sc-436987-NIC-2 20 µg

Vmn2r58 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit
MBS2503797-01 24 Tests

Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit
MBS2503797-02 48 Tests

Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit
MBS2503797-03 96 Tests

Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit
MBS2503797-04 5x 96 Tests

Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details
Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit
MBS2503797-05 10x 96 Tests

Chicken MANF (Mesencephalic Astrocyte Derived Neurotrophic Factor) ELISA Kit

Sign In for Pricing
View Details