Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Halobacterium sp. Halorhodopsin (hop)

This Recombinant Halobacterium sp. Halorhodopsin (hop) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Halorhodopsin, HR

UniProt

O93741

Expression Region

1-297

Origin

Halobacterium sp. (strain arg-4)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRSRTYHDQSVCGPYGSQRTDCDRDTDAGSDTDVHGAQVATQIRTDTLLHSSLWVNIALA GLSILVFLYMARTVRANRARLIVGATLMIPLVSLSSYLGLVTGLTAGPIEMPAAHALAGE DVLSQWGRYLTWTLSTPMILLALGWLAEVDTADLFVVIAADIGMCLTGLAAALTTSSYAF RWAFYLVSTAFFVVVLYALLAKWPTNAEAAGTGDIFGTLRWLTVILWLGYPILWALGVEG FALVDSVGLTSWGYSLLDIGAKYLFAALLLRWVANNERTIAVGQRSGRGAIGDPVED

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC6A7 activation kit by CRISPRa
GA104458 1 Kit

Human SLC6A7 activation kit by CRISPRa

Sign In for Pricing
View Details
HLA-DQ (MHC II) (HLA-DQA1/2866R), CF740 conjugate, 0.1mg/mL
BNC742866-100 1x 100 µL

HLA-DQ (MHC II) (HLA-DQA1/2866R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tmem120b Mouse Gene Knockout Kit (CRISPR)
KN517706 1 Kit

Tmem120b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
HLA-Pan (MHC II) (HLA-Pan/2967R), CF488A conjugate, 0.1mg/mL
BNC882967-500 1x 500 µL

HLA-Pan (MHC II) (HLA-Pan/2967R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ABHD14B Polyclonal Antibody
E-AB-52328-01 20 µL

ABHD14B Polyclonal Antibody

Sign In for Pricing
View Details
ABHD14B Polyclonal Antibody
E-AB-52328-02 60 µL

ABHD14B Polyclonal Antibody

Sign In for Pricing
View Details