Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt)

This Recombinant Prochlorococcus marinus Prolipoprotein diacylglyceryl transferase (lgt) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Prolipoprotein diacylglyceryl transferase, EC= 2.4.99.-

UniProt

Q31C74

Expression Region

1-297

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLIFQAFIQSPGETFLNLGFLTIRWYGFLISVSVIIGLFVSKKLAKARNINPLYISEILP SLIIFSIIGARAYYVIFEWRQYSGENLFTSLELFNNTIQIPSFLAVWEGGIAIHGGLIGG LLSIIYFCKSKNIHLKTFIDILIPSIILGQSIGRWGNFFNNEAFGVPTNLPWKLFIPIQN RPLEFINYEFFHPTFLYESLWNFLIFILLIFVFNKQNKTDFFRPGFISCLYLISYSFGRF WIEGLRTDPLCIGGLPPFCSGGIRMAQFISIFLFSSGLIGIFFLRLRTYSCKNRKNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-100 1x 100 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF647 conjugate, 0.1mg/mL
BNC472336-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (ACP5/2336R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Beta-2 Microglobulin (B2M) (B2M/961), CF740 conjugate, 0.1mg/mL
BNC740961-100 1x 100 µL

Beta-2 Microglobulin (B2M) (B2M/961), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF405S conjugate, 0.1mg/mL
BNC042346-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL
BNC940902-100 1x 100 µL

Nucleolin (NCL/902), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details