Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0923 (MJ0923)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0923 (MJ0923) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0923

UniProt

Q58333

Expression Region

1-297

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEIFKLLRKDRKMLFLMFIGTVSFLFIFIPFLKFQMIGSSHKINAYPSLSAVCGLLLGPI YGFFAVMLVTLIYFFLNPKAFYFGIYSLIPPTLAVISAGALSEGKWKYSAIILIVGLLLF YLTDVGRVAFYYPYLSTLALLLILIFREKISKLLFSKDWKKMIVGATILSFSSVMTDHLY GSILGIVYLHLPAEDYISVIPLFIKERLIMTVIGAFFVIFAIEISKCFLKNATKLKEKLL KSYIDKEIKINCKNMLNVDEELLKKYNVKIPSEEEQKEILKTLVEVVVFNNDKDENR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (MME) (NM_007288) Human Recombinant Protein
E45H37025M5 20 µg

CD10 (MME) (NM_007288) Human Recombinant Protein

Sign In for Pricing
View Details
Compound NP-008104
T130309-01 10 mg

Compound NP-008104

Sign In for Pricing
View Details
Compound NP-008104
T130309-02 1 g

Compound NP-008104

Sign In for Pricing
View Details
Compound NP-008104
T130309-03 1 mg

Compound NP-008104

Sign In for Pricing
View Details
Compound NP-008104
T130309-04 50 mg

Compound NP-008104

Sign In for Pricing
View Details
Compound NP-008104
T130309-05 5 mg

Compound NP-008104

Sign In for Pricing
View Details