Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Adrenocorticotropic hormone receptor (MC2R)

This Recombinant Pig Adrenocorticotropic hormone receptor (MC2R) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Adrenocorticotropic hormone receptor, ACTH receptor, ACTH-R, Adrenocorticotropin receptor, Melanocortin receptor 2, MC2-R

UniProt

Q8HYN8

Expression Region

1-297

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKHITDLYESVNSTMSNKSDCPPVVLPEEVFFTISVIGVLENLIVLLAVIKNKNLQSPMY FFICSLAISDMLGSLYKILENILIIFRNMGYLEPRGGFESTADDVVDSLFILSLLGSICS LSAIAADRYITIFHALQYQRLVTPRRAAVVLLIIWACCIGSGITIVTFSHHVPAVIAFTA LFPLMLVFILCLYGHMFLLARSHARRVSTLPRANMKGAITLTVLLGVFIFCWAPFVLHIL LMTFCPADPYCACYLALFQVNAVLIMCNAIIDPFIYAFRSPELRDAFKKMIICKRYP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF647 conjugate, 0.1mg/mL
BNC470338-500 1x 500 µL

P53 (PAb122), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL
BNC472848-500 1x 500 µL

Fibronectin (Fn-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (122.2), CF488A conjugate, 0.1mg/mL
BNC880175-100 1x 100 µL

CD46 (122.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF647 conjugate, 0.1mg/mL
BNC471798-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (EGP40/1798), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF740 conjugate, 0.1mg/mL
BNC741976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details