Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 4 (Tas2r4)

This Recombinant Mouse Taste receptor type 2 member 4 (Tas2r4) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4, Taste receptor type 2 member 8, T2R8

UniProt

Q9JKT3

Expression Region

1-297

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWELYVFVFAASVFLNFVGIIANLFIIVIIIKTWVNSRRIASPDRILFSLAITRFLTLG LFLLNSVYIATNTGRSVYFSTFFLLCWKFLDANSLWLVTILNSLYCVKITNFQHPVFLLL KRTISMKTTSLLLACLLISALTTLLYYMLSQISRFPEHIIGRNDTSFDLSDGILTLVASL VLNSLLQFMLNVTFASLLIHSLRRHIQKMQRNRTSFWNPQTEAHMGAMRLMICFLVLYIP YSIATLLYLPSYMRKNLRAQAICMIITAAYPPGHSVLLIITHHKLKAKAKKIFCFYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS6 (NM_004232) Human Over-expression Lysate
LC401359 20 µg

SOCS6 (NM_004232) Human Over-expression Lysate

Sign In for Pricing
View Details
TM16J Antibody
8C10001-AAT 50 µg

TM16J Antibody

Sign In for Pricing
View Details
Manual Pipette Controller BPIP-406
BPIP-406 1 Unit

Manual Pipette Controller BPIP-406

Sign In for Pricing
View Details
3- (N-morpholino) propane-sulfonic Acid, MOPS, 100g
PC0928-100g 100 g

3- (N-morpholino) propane-sulfonic Acid, MOPS, 100g

Sign In for Pricing
View Details
MEF2A Rabbit Polyclonal Antibody
AP06372PU-N 100 µg

MEF2A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cell Meter™ Cellular Senescence Activity Assay Kit *Green Fluorescence*
23005-AAT 100 Tests

Cell Meter™ Cellular Senescence Activity Assay Kit *Green Fluorescence*

Sign In for Pricing
View Details