Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Taste receptor type 2 member 4 (Tas2r4)

This Recombinant Mouse Taste receptor type 2 member 4 (Tas2r4) spans the amino acid sequence from region 1-297.

Product Specifications

Product Name Alternative

Taste receptor type 2 member 4, T2R4, Taste receptor type 2 member 8, T2R8

UniProt

Q9JKT3

Expression Region

1-297

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLWELYVFVFAASVFLNFVGIIANLFIIVIIIKTWVNSRRIASPDRILFSLAITRFLTLG LFLLNSVYIATNTGRSVYFSTFFLLCWKFLDANSLWLVTILNSLYCVKITNFQHPVFLLL KRTISMKTTSLLLACLLISALTTLLYYMLSQISRFPEHIIGRNDTSFDLSDGILTLVASL VLNSLLQFMLNVTFASLLIHSLRRHIQKMQRNRTSFWNPQTEAHMGAMRLMICFLVLYIP YSIATLLYLPSYMRKNLRAQAICMIITAAYPPGHSVLLIITHHKLKAKAKKIFCFYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK15 (NM_139021) Human Over-expression Lysate
LC403383 20 µg

MAPK15 (NM_139021) Human Over-expression Lysate

Sign In for Pricing
View Details
Calcium Sensing Receptor (CASR) (N-term) Rabbit Polyclonal Antibody
AP22631PU-N 250 µL

Calcium Sensing Receptor (CASR) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
a-(4-Chlorophenyl)-2-ethyl-1,3-dioxolane-2-acetonitrile
TRC-C422235-500MG 500 mg

a-(4-Chlorophenyl)-2-ethyl-1,3-dioxolane-2-acetonitrile

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS704697 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
FOXP4 (NM_138457) Human Recombinant Protein
TP308077L 1 mg

FOXP4 (NM_138457) Human Recombinant Protein

Sign In for Pricing
View Details
Human FBXW8 activation kit by CRISPRa
GA108824 1 Kit

Human FBXW8 activation kit by CRISPRa

Sign In for Pricing
View Details