Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Post-GPI attachment to proteins factor 3 (Pgap3)

This Recombinant Mouse Post-GPI attachment to proteins factor 3 (Pgap3) spans the amino acid sequence from region 24-320.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A2A559

Expression Region

24-320

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DREPVYRDCVLRCEERNCSGDALKHFRSRQPIYMSLAGWTCRDDCKYECMWFTVGLYLQE GHRVPQFHGKWPFSRFLFIQEPASAVASLLNGLASLVMLCRYRASVPASSPMYHTCMAFA WVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSVYLCCVRTVGLQHPSVASAFGALL LLLLTGHISYLSLVHFDYGYNMMANVAIGLVNLAWWLVWCLRNRQRLPHTRRCMVVVVLL QGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESGAMFKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit
MBS9907306-01 48 Well

Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit

Sign In for Pricing
View Details
Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit
MBS9907306-02 96 Well

Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit

Sign In for Pricing
View Details
Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit
MBS9907306-03 5x 96 Well

Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit

Sign In for Pricing
View Details
Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit
MBS9907306-04 10x 96 Well

Camel Fanconi Anemia Group M Protein (FANCM) ELISA Kit

Sign In for Pricing
View Details
Silver Oxide pure, 99%
69668-01 10 g

Silver Oxide pure, 99%

Sign In for Pricing
View Details
Silver Oxide pure, 99%
69668-02 25 g

Silver Oxide pure, 99%

Sign In for Pricing
View Details