Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3)

This Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3) spans the amino acid sequence from region 20-316.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A8WFS8

Expression Region

20-316

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAE GYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFS LVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLL ILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLL HGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calm3 Mouse Gene Knockout Kit (CRISPR)
KN502463 1 Kit

Calm3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Insrr activation kit by CRISPRa
GA204812 1 Kit

Mouse Insrr activation kit by CRISPRa

Sign In for Pricing
View Details
RAB18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C9]
TA811906AM 100 µL

RAB18 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI7C9]

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS801409 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
EnzyChrom™ Superoxide Dismutase Assay Kit
ESOD-100 100 Tests

EnzyChrom™ Superoxide Dismutase Assay Kit

Sign In for Pricing
View Details
WBSCR16 Polyclonal Antibody
E-AB-90805-01 60 µL

WBSCR16 Polyclonal Antibody

Sign In for Pricing
View Details