Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3)

This Recombinant Danio rerio Post-GPI attachment to proteins factor 3 (pgap3) spans the amino acid sequence from region 20-316.

Product Specifications

Product Name Alternative

Post-GPI attachment to proteins factor 3, PER1-like domain-containing protein 1

UniProt

A8WFS8

Expression Region

20-316

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAE GYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFS LVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLL ILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLL HGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Taf4 Mouse Gene Knockout Kit (CRISPR)
KN517147 1 Kit

Taf4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TentaGel® HL FMP
HL12016.5G 5 g

TentaGel® HL FMP

Sign In for Pricing
View Details
MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL
BNC040200-500 1x 500 µL

MHC II (HLA-DQ) (SPV-L3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18/1190), CF488A conjugate, 0.1mg/mL
BNC881190-500 1x 500 µL

Cytokeratin 18 (KRT18/1190), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MSK2 / RSK-B (RPS6KA4) (NM_001006944) Human Over-expression Lysate
LY423559 100 µg

MSK2 / RSK-B (RPS6KA4) (NM_001006944) Human Over-expression Lysate

Sign In for Pricing
View Details
Trifarotene
TRC-T766005-5MG 5 mg

Trifarotene

Sign In for Pricing
View Details