Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit E (mtrE)

This Recombinant Methanopyrus kandleri Tetrahydromethanopterin S-methyltransferase subunit E (mtrE) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Tetrahydromethanopterin S-methyltransferase subunit E, EC= 2.1.1.86, N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit E

UniProt

Q49606

Expression Region

1-298

Origin

Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGFTEIGLAAAMGALATIAGAFEDAESDVGSQSNPNSQVQLAPQMMNFHRYFNKAISGE PVSYMLYGAIAGTVTWVMMTKFGLPFLAAAAVGVGVNALIHMVFATTAHLGRMASAAEFG HPIYLDVVLSHLGPIAGFGGIATFAIVSLAYIQWALLKHPFPLPLLAALWGVTVGAIGSS TGDVHYGAERLYQHYPFGGGVPVAAHGNITRKAETGIRNSMDSVYFCAKFGNPLTGLCFG LVVFFSTWAGLFGQWGAVIAMGLVTLGCLIVSNRVEKKARESYGTYEDVEMDEICDPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-100 1x 100 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL
BNC401429-500 1x 500 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-100 1x 100 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), CF640R conjugate, 0.1mg/mL
BNC401234-500 1x 500 µL

Bcl-2 (100/D5 + 124), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CYCS/1010), CF568 conjugate, 0.1mg/mL
BNC681010-100 1x 100 µL

Cytochrome C (CYCS/1010), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF405S conjugate, 0.1mg/mL
BNC040931-500 1x 500 µL

CD46 (197-2B1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details