Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 10D4 (OR10D4P)

This Recombinant Human Putative olfactory receptor 10D4 (OR10D4P) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Putative olfactory receptor 10D4

UniProt

Q8NGN7

Expression Region

1-298

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRNHTMVTEFILLGIPETEGLETALLFLFSSFYLCTLLGNVLILTAIISSTRLHTPMYFF LGNLSIFDLGFSSTTVPKMLFYLSGNSHAISYAGCVSQLFFYHFLGCTECFLYTVMACDR FVAICFPLRYTVIMNHRVCFMLATGTWMIGCVHAMILTPLTFQLPYCGPNKVGYYFCDIP AVLPLACKDTSLAQRVGFTNVGLLSLICFFLILVSYTCIGISISKIRSAEGRQRAFSTCS AHLTAILCAYGPVIVIYLQPNPSALLGSIIQILNNLVTPMLNPLIYSLRNKDVKSDQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate
LC420631 20 µg

BAT3 (BAG6) (NM_001098534) Human Over-expression Lysate

Sign In for Pricing
View Details
CD68 CytoSection
TS400392P5 25 Slides

CD68 CytoSection

Sign In for Pricing
View Details
QZ59S-SSS
TRC-Q990000-5MG 5 mg

QZ59S-SSS

Sign In for Pricing
View Details
GLMN Human Gene Knockout Kit (CRISPR)
KN401521 1 Kit

GLMN Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rhox2g Mouse Gene Knockout Kit (CRISPR)
KN514790 1 Kit

Rhox2g Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TTLL2 activation kit by CRISPRa
GA113296 1 Kit

Human TTLL2 activation kit by CRISPRa

Sign In for Pricing
View Details