Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative olfactory receptor 5AK3 (OR5AK3P)

This Recombinant Human Putative olfactory receptor 5AK3 (OR5AK3P) spans the amino acid sequence from region 1-298.

Product Specifications

Product Name Alternative

Putative olfactory receptor 5AK3

UniProt

Q8NH89

Expression Region

1-298

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRGNSTEVTEFHLLGFGVQHEFQHVLFIVLLLIYVTSLIGNIGMILLIKTDSRLQTPMY FFPQHLAFVDICYTSAITPKMLQSFTEENNLITFRGCVIQFLVYATFATSDCYLLAIMAM DCYVAICKPLRYPMIMSQTVYIQLVAGSYIIGSINASVHTGFTFSLSFCKSNKINHFFCD GLPILALSCSNIDINIILDVVFVGFDLMFTELVIIFSYIYIMVTILKMSSTAGRKKSFST CASHLTAVTIFYGTLSYMYLQPQSNNSQENMKVASIFYGTVIPMLNPLIYSLRNKEGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Protein NLRC5 (NLRC5) ELISA Kit
NSL1267Bo 96 Tests

Bovine Protein NLRC5 (NLRC5) ELISA Kit

Sign In for Pricing
View Details
TAF5L Over-expression Lysate Product
GWB-E688C0 0.1 mg

TAF5L Over-expression Lysate Product

Sign In for Pricing
View Details
Monkey amyloid beta peptide 1-42, Aβ1-42 GENLISA ELISA
KLW0093 96 Well

Monkey amyloid beta peptide 1-42, Aβ1-42 GENLISA ELISA

Sign In for Pricing
View Details
Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit
EK16864 48 Tests

Equine Transforming Growth Factor Beta 1 (TGFb1) ELISA Kit

Sign In for Pricing
View Details
Porcine Reticulon 1B (RTN1B) ELISA Kit
MBS9345488-01 48 Well

Porcine Reticulon 1B (RTN1B) ELISA Kit

Sign In for Pricing
View Details
Porcine Reticulon 1B (RTN1B) ELISA Kit
MBS9345488-02 96 Well

Porcine Reticulon 1B (RTN1B) ELISA Kit

Sign In for Pricing
View Details